PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.N01298.1.p
Common NameLOC105954616, MIMGU_mgv1a012572mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family BBR-BPC
Protein Properties Length: 247aa    MW: 27889.9 Da    PI: 10.0612
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.N01298.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind35.53.3e-1112901693
         GAGA_bind 16 paaslkenlglqlmssiaerdakirernlalsekkaavaerdmaflqrdkalaernkalverdnkllalllvensla...s 93
                      ++++++   + ++  + +e++a+++er+ a+se+ka ++e + a +qrd a+ ern+al erdn+++al+++e ++    s
  Migut.N01298.1.p 12 EQNAFN--TTAKIGILFEEKEAALKERDKAISETKAILKEMEFAITQRDLAIIERNNALKERDNAIAALQFHESNMRnpiS 90
                      444444..6667777788******************************************************999774432 PP

2GAGA_bind238.74.2e-7397245150300
         GAGA_bind 150 kkkrqrakkpkekkakkkkkksekskkkvkkesaderskaekksidl..vlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiS 240
                        k++++ k + ++ +kk+kk +e+ +++v++      skae++++dl  +l+ + +Dest+PvPvCsCtG+ rqCYkWG GGWqS+CCtt++S
  Migut.N01298.1.p  97 AKASRNVKIKSSRSSKKAKKMGEDLNRQVTTY----GSKAEWEDQDLgsTLQMIRFDESTMPVPVCSCTGVARQCYKWGKGGWQSSCCTTALS 185
                       22222233333333344455444554444444....499********777******************************************* PP

         GAGA_bind 241 vyPLPvstkrrgaRiagrKmSqgafkklLekLaaeGydlsnpvDLkdhWAkHGtnkfvti 300
                        yPLP+++++r+aR++grKmS+ +f++lL +L + G+dls p+DLk +WAkHGtn+++ti
  Migut.N01298.1.p 186 EYPLPQMPNKRHARMGGRKMSGTVFSRLLTRLGTAGHDLSVPLDLKIYWAKHGTNRYITI 245
                       ***********************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012268.2E-865246IPR010409GAGA-binding transcriptional activator
PfamPF062172.2E-7098245IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0050793Biological Processregulation of developmental process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MWNMMQYQHF SEQNAFNTTA KIGILFEEKE AALKERDKAI SETKAILKEM EFAITQRDLA  60
IIERNNALKE RDNAIAALQF HESNMRNPIS EVPTSRAKAS RNVKIKSSRS SKKAKKMGED  120
LNRQVTTYGS KAEWEDQDLG STLQMIRFDE STMPVPVCSC TGVARQCYKW GKGGWQSSCC  180
TTALSEYPLP QMPNKRHARM GGRKMSGTVF SRLLTRLGTA GHDLSVPLDL KIYWAKHGTN  240
RYITIT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012833734.10.0PREDICTED: protein BASIC PENTACYSTEINE4
SwissprotQ8S8C64e-93BPC4_ARATH; Protein BASIC PENTACYSTEINE4
TrEMBLA0A022RL120.0A0A022RL12_ERYGU; Uncharacterized protein
STRINGPGSC0003DMT4000041791e-103(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA92872128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G21240.22e-90basic pentacysteine 4